PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0101s0020.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family GATA
Protein Properties Length: 357aa    MW: 38215 Da    PI: 7.5494
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0101s0020.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA511.9e-16259292134
                 GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                          C +C  tkTp+WR gp g+ktLCnaCG+++++ +
  Kaladp0101s0020.2.p 259 CLHCEITKTPQWRAGPMGPKTLCNACGVRHKSGR 292
                          99*****************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169924.7E-693333IPR016679Transcription factor, GATA, plant
SMARTSM004013.6E-15253303IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.266253289IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.102.6E-14257290IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577162.99E-14257316No hitNo description
CDDcd002023.17E-13258305No hitNo description
PROSITE patternPS003440259284IPR000679Zinc finger, GATA-type
PfamPF003204.0E-14259292IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MSADPTSLVV EDLDCNSFFG HIEDLLDFPE VNNKNSHNAP LVAPGLAWNA PPYSFFNPDL  60
LFIGKGSACT QDLAAELSIP YEDIVQMEWL STFVEDSFSG GDSMTLDKKS FPSTKEASAD  120
AAVAPVQFLS SSPISVLESS SSSSCSEGSK ALLVSPDSAR VRGGCGRPRS KRPRPHTFKP  180
GSAMQLISPA QSFTDTPQLS ASHGAFQGNK FKQSPHLTTE QNKKRKMKPS SSPATPAAEM  240
SNNETGAADP QSQAGVRKCL HCEITKTPQW RAGPMGPKTL CNACGVRHKS GRLFPEYRPA  300
ASPTFVPSLH SNSHKKVLEM RTATVHTPAT TPPGGKMGSD THPELIPNEK AILEYM*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1170174KRPRP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006574762.12e-91PREDICTED: GATA transcription factor 8-like isoform X2
RefseqXP_006574763.12e-91PREDICTED: GATA transcription factor 8-like isoform X2
TrEMBLK7K6X93e-91K7K6X9_SOYBN; Uncharacterized protein
STRINGGLYMA02G08145.17e-91(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54810.28e-39GATA family protein